HORDB

ID: hor006700
Uniprot ID: Q9XT35
Protein name: Parathyroid hormone
Gene name: PTH
Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Family: Parathyroid hormone family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
GO BP: GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0045725 positive regulation of glycogen biosynthetic process; GO:0046326 positive regulation of glucose import
GO CC: GO:0005576 extracellular region

Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ
Length: 84(32-115)
Propeptide: MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ
Signal peptide: MIPAKDMAKVMIVMLAICFLTKSDG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells (By similarity).
Mechanism: NA
Cross BBB: NA
Target: PTH1R, PTH2R
Target Unid: A0A2K5V724, G7PLB3
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006700_AF2.pdb

hor006700_ESM.pdb

Mass:	1093444	Formula:	C410H677N125O127S2
Absent amino acids:	CY	Common amino acids:	LK
pI:	9.18	Basic residues:	18
Polar residues:	16	Hydrophobic residues:	28
Hydrophobicity:	-73.33	Boman Index:	-20363
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	89.4
Instability Index:	4620.12	Extinction Coefficient cystines:	5500
Absorbance 280nm:	66.27